HORDB

ID: hor004713
Uniprot ID: Q9SRY3(72-120)
Protein name: Protein RALF-like 1
Gene name: RALF1
Organism: Arabidopsis thaliana (Mouse-ear cress)
Family: Plant rapid alkalinization factor (RALF) family
Source: Plant
Expression: More efficient to mediate cytoplasmic Ca(2+) accumulation when oxidized, but inactive when reduced. |First detected in the root hair zone of seedlings, mostly in the vascular bundles, cortex, and endodermis. Later observed in hypocotyls and veins of cotyl
Disease: NA
Comments: NA
Taxonomy: Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005515 protein binding
GO BP: GO:0007267 cell-cell signaling; GO:0019722 calcium-mediated signaling; GO:0030308 negative regulation of cell growth; GO:0048364 root development
GO CC: GO:0005576 extracellular region; GO:0048046 apoplast

Sequence: ATTKYISYQSLKRNSVPCSRRGASYYNCQNGAQANPYSRGCSKIARCRS
Length: 49(72-120)
Propeptide: MDKSFTLFLTLTILVVFIISSPPVQAGFANDLGGVAWATTGDNGSGCHGSIAECIGAEEEEMDSEINRRILATTKYISYQSLKRNSVPCSRRGASYYNCQNGAQANPYSRGCSKIARCRS
Signal peptide: MDKSFTLFLTLTILVVFIISSPPVQA
Modification: NA
Glycosylation: NA
Mutagenesis: Loss of propeptide cleavage by kexin-like convertase leading to an impaired activity. : T69 R ???A

Function: Cell signaling peptide that may regulate plant stress, growth, and development. Mediates a rapid alkalinization of extracellular space by mediating a transient increase in the cytoplasmic Ca(2+) concentration leading to a calcium-dependent signaling event
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004713_AF2.pdb

hor004713_ESM.pdb

Mass:	632345	Formula:	C228H367N77O72S4
Absent amino acids:	DEFHMW	Common amino acids:	S
pI:	10.36	Basic residues:	9
Polar residues:	26	Hydrophobic residues:	9
Hydrophobicity:	-93.67	Boman Index:	-14660
Half-Life:	4.4 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	40
Instability Index:	4500.2	Extinction Coefficient cystines:	7700
Absorbance 280nm:	160.42

PubMed ID: 18494498
Title: A cytoplasmic Ca2+ functional assay for identifying and purifying endogenous cell signaling peptides in Arabidopsis seedlings: identification of AtRALF1 peptide.
PubMed ID: 18775699
Title: A conserved dibasic site is essential for correct processing of the peptide hormone AtRALF1
PubMed ID: 24458638
Title: