General Information

  • ID:  hor004713
  • Uniprot ID:  Q9SRY3
  • Protein name:  Protein RALF-like 1
  • Gene name:  RALF1
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  Plant rapid alkalinization factor (RALF) family
  • Source:  Plant
  • Expression:  More efficient to mediate cytoplasmic Ca(2+) accumulation when oxidized, but inactive when reduced. |First detected in the root hair zone of seedlings, mostly in the vascular bundles, cortex, and endodermis. Later observed in hypocotyls and veins of cotyl
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005515 protein binding
  • GO BP:  GO:0007267 cell-cell signaling; GO:0019722 calcium-mediated signaling; GO:0030308 negative regulation of cell growth; GO:0048364 root development
  • GO CC:  GO:0005576 extracellular region; GO:0048046 apoplast

Sequence Information

  • Sequence:  ATTKYISYQSLKRNSVPCSRRGASYYNCQNGAQANPYSRGCSKIARCRS
  • Length:  49(72-120)
  • Propeptide:  MDKSFTLFLTLTILVVFIISSPPVQAGFANDLGGVAWATTGDNGSGCHGSIAECIGAEEEEMDSEINRRILATTKYISYQSLKRNSVPCSRRGASYYNCQNGAQANPYSRGCSKIARCRS
  • Signal peptide:  MDKSFTLFLTLTILVVFIISSPPVQA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  Loss of propeptide cleavage by kexin-like convertase leading to an impaired activity. : T69 R ???A

Activity

  • Function:  Cell signaling peptide that may regulate plant stress, growth, and development. Mediates a rapid alkalinization of extracellular space by mediating a transient increase in the cytoplasmic Ca(2+) concentration leading to a calcium-dependent signaling event
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  18-28; 41-47
  • Structure ID:  AF-Q9SRY3-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004713_AF2.pdbhor004713_ESM.pdb

Physical Information

Mass: 632345 Formula: C228H367N77O72S4
Absent amino acids: DEFHMW Common amino acids: S
pI: 10.36 Basic residues: 9
Polar residues: 26 Hydrophobic residues: 9
Hydrophobicity: -93.67 Boman Index: -14660
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 40
Instability Index: 4500.2 Extinction Coefficient cystines: 7700
Absorbance 280nm: 160.42

Literature

  • PubMed ID:  18494498
  • Title:  A cytoplasmic Ca2+ functional assay for identifying and purifying endogenous cell signaling peptides in Arabidopsis seedlings: identification of AtRALF1 peptide.
  • PubMed ID:  18775699
  • Title:  A conserved dibasic site is essential for correct processing of the peptide hormone AtRALF1
  • PubMed ID:  24458638
  • Title: